Login to display prices
Login to display prices
TMEPAI (Human) Recombinant Protein (Q01) View larger

TMEPAI (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEPAI (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about TMEPAI (Human) Recombinant Protein (Q01)

Product description: Human TMEPAI partial ORF ( AAH15918, 181 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 56937
Gene name: PMEPA1
Gene alias: STAG1|TMEPAI
Gene description: prostate transmembrane protein, androgen induced 1
Genbank accession: BC015918
Immunogen sequence/protein sequence: NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Protein accession: AAH15918
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Size: 10 ug
Shipping condition: Dry Ice

30 other products in the same category: