TMEPAI monoclonal antibody (M01), clone 2A12 View larger

TMEPAI monoclonal antibody (M01), clone 2A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEPAI monoclonal antibody (M01), clone 2A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMEPAI monoclonal antibody (M01), clone 2A12

Brand: Abnova
Reference: H00056937-M01
Product name: TMEPAI monoclonal antibody (M01), clone 2A12
Product description: Mouse monoclonal antibody raised against a partial recombinant TMEPAI.
Clone: 2A12
Isotype: IgG2a Kappa
Gene id: 56937
Gene name: PMEPA1
Gene alias: STAG1|TMEPAI
Gene description: prostate transmembrane protein, androgen induced 1
Genbank accession: BC015918
Immunogen: TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Protein accession: AAH15918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056937-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056937-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TMEPAI is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - DUSP22 monoclonal antibody (M01), clone 3D3
- MRPS22 monoclonal antibody (M10), clone 1E1
- C11orf30 monoclonal antibody (M01), clone 5D1
- XAB2 monoclonal antibody (M01), clone 1D1-1A9
- NT5M monoclonal antibody (M02), clone 3E2
Shipping condition: Dry Ice
Publications: TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.Singha PK, Pandeswara S, Geng H, Lan R, Venkatachalam MA, Saikumar P
Genes Cancer. 2014 Sep;5(9-10):320-36.

Buy TMEPAI monoclonal antibody (M01), clone 2A12 now

Add to cart