Login to display prices
Login to display prices
TMEPAI monoclonal antibody (M01), clone 2A12 View larger

TMEPAI monoclonal antibody (M01), clone 2A12

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEPAI monoclonal antibody (M01), clone 2A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMEPAI monoclonal antibody (M01), clone 2A12

Product description: Mouse monoclonal antibody raised against a partial recombinant TMEPAI.
Clone: 2A12
Isotype: IgG2a Kappa
Gene id: 56937
Gene name: PMEPA1
Gene alias: STAG1|TMEPAI
Gene description: prostate transmembrane protein, androgen induced 1
Genbank accession: BC015918
Immunogen: TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Protein accession: AAH15918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: