Login to display prices
Login to display prices
CA10 monoclonal antibody (M01), clone 1A10 View larger

CA10 monoclonal antibody (M01), clone 1A10

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CA10 monoclonal antibody (M01), clone 1A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CA10 monoclonal antibody (M01), clone 1A10

Product description: Mouse monoclonal antibody raised against a partial recombinant CA10.
Clone: 1A10
Isotype: IgG2a Kappa
Gene id: 56934
Gene name: CA10
Gene alias: CA-RPX|CARPX|HUCEP-15
Gene description: carbonic anhydrase X
Genbank accession: NM_020178
Immunogen: CA10 (NP_064563.1, 229 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Protein accession: NP_064563.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: