CA10 monoclonal antibody (M01), clone 1A10 View larger

CA10 monoclonal antibody (M01), clone 1A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CA10 monoclonal antibody (M01), clone 1A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CA10 monoclonal antibody (M01), clone 1A10

Brand: Abnova
Reference: H00056934-M01
Product name: CA10 monoclonal antibody (M01), clone 1A10
Product description: Mouse monoclonal antibody raised against a partial recombinant CA10.
Clone: 1A10
Isotype: IgG2a Kappa
Gene id: 56934
Gene name: CA10
Gene alias: CA-RPX|CARPX|HUCEP-15
Gene description: carbonic anhydrase X
Genbank accession: NM_020178
Immunogen: CA10 (NP_064563.1, 229 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Protein accession: NP_064563.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056934-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056934-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CA10 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Related products: - TMEPAI monoclonal antibody (M01), clone 2A12
- DUSP22 monoclonal antibody (M01), clone 3D3
- MRPS22 monoclonal antibody (M10), clone 1E1
- C11orf30 monoclonal antibody (M01), clone 5D1
- XAB2 monoclonal antibody (M01), clone 1D1-1A9
Shipping condition: Dry Ice

Buy CA10 monoclonal antibody (M01), clone 1A10 now

Add to cart