CA10 MaxPab mouse polyclonal antibody (B01) View larger

CA10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CA10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CA10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056934-B01
Product name: CA10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CA10 protein.
Gene id: 56934
Gene name: CA10
Gene alias: CA-RPX|CARPX|HUCEP-15
Gene description: carbonic anhydrase X
Genbank accession: NM_020178.3
Immunogen: CA10 (NP_064563.1, 1 a.a. ~ 328 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Protein accession: NP_064563.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056934-B01-13-15-1.jpg
Application image note: Western Blot analysis of CA10 expression in transfected 293T cell line (H00056934-T01) by CA10 MaxPab polyclonal antibody.

Lane 1: CA10 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - DUSP22 polyclonal antibody (A01)
- DUSP22 MaxPab mouse polyclonal antibody (B01)
- DUSP22 purified MaxPab mouse polyclonal antibody (B01P)
- DUSP22 MaxPab rabbit polyclonal antibody (D01)
- DUSP22 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy CA10 MaxPab mouse polyclonal antibody (B01) now

Add to cart