DUS3L (Human) Recombinant Protein (P01) View larger

DUS3L (Human) Recombinant Protein (P01)

New product

279,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUS3L (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about DUS3L (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00056931-P01
Product name: DUS3L (Human) Recombinant Protein (P01)
Product description: Human DUS3L full-length ORF ( NP_064560.1, 1 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 56931
Gene name: DUS3L
Gene alias: DUS3|FLJ13896
Gene description: dihydrouridine synthase 3-like (S. cerevisiae)
Genbank accession: NM_020175.1
Immunogen sequence/protein sequence: MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK
Protein accession: NP_064560.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00056931-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - CA10 (Human) Recombinant Protein (Q01)
- CA10 (Human) Recombinant Protein (Q02)
- TMEPAI (Human) Recombinant Protein (Q01)
- ARNTL2 (Human) Recombinant Protein (Q01)
- DUSP22 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy DUS3L (Human) Recombinant Protein (P01) now

Add to cart