Login to display prices
Login to display prices
DUS3L MaxPab mouse polyclonal antibody (B01) View larger

DUS3L MaxPab mouse polyclonal antibody (B01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUS3L MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Tr

More info about DUS3L MaxPab mouse polyclonal antibody (B01)

Product description: Mouse polyclonal antibody raised against a full-length human DUS3L protein.
Gene id: 56931
Gene name: DUS3L
Gene alias: DUS3|FLJ13896
Gene description: dihydrouridine synthase 3-like (S. cerevisiae)
Genbank accession: NM_020175
Immunogen: DUS3L (NP_064560, 1 a.a. ~ 650 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK
Protein accession: NP_064560
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Size: 50 uL
Shipping condition: Dry Ice

30 other products in the same category: