DUS3L MaxPab mouse polyclonal antibody (B01) View larger

DUS3L MaxPab mouse polyclonal antibody (B01)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUS3L MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DUS3L MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056931-B01
Product name: DUS3L MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DUS3L protein.
Gene id: 56931
Gene name: DUS3L
Gene alias: DUS3|FLJ13896
Gene description: dihydrouridine synthase 3-like (S. cerevisiae)
Genbank accession: NM_020175
Immunogen: DUS3L (NP_064560, 1 a.a. ~ 650 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK
Protein accession: NP_064560
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056931-B01-13-15-1.jpg
Application image note: Western Blot analysis of DUS3L expression in transfected 293T cell line (H00056931-T01) by DUS3L MaxPab polyclonal antibody.

Lane 1: DUS3L transfected lysate(71.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - CA10 MaxPab mouse polyclonal antibody (B01)
- DUSP22 polyclonal antibody (A01)
- DUSP22 MaxPab mouse polyclonal antibody (B01)
- DUSP22 purified MaxPab mouse polyclonal antibody (B01P)
- DUSP22 MaxPab rabbit polyclonal antibody (D01)
Shipping condition: Dry Ice

Buy DUS3L MaxPab mouse polyclonal antibody (B01) now

Add to cart