Login to display prices
Login to display prices
GPR108 (Human) Recombinant Protein View larger

GPR108 (Human) Recombinant Protein

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR108 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Func,Screening

More info about GPR108 (Human) Recombinant Protein

Product description: Human GPR108 full-length ORF (ENSP00000264080) recombinant protein without tag.
Gene id: 56927
Gene name: GPR108
Gene alias: LUSTR2|MGC14393
Gene description: G protein-coupled receptor 108
Genbank accession: ENST00000264080
Immunogen sequence/protein sequence: MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Protein accession: ENSP00000264080
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Size: 2 ug
Shipping condition: Dry Ice

30 other products in the same category: