GPR108 (Human) Recombinant Protein View larger

GPR108 (Human) Recombinant Protein

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR108 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP

More info about GPR108 (Human) Recombinant Protein

Brand: Abnova
Reference: H00056927-G01
Product name: GPR108 (Human) Recombinant Protein
Product description: Human GPR108 full-length ORF (ENSP00000264080) recombinant protein without tag.
Gene id: 56927
Gene name: GPR108
Gene alias: LUSTR2|MGC14393
Gene description: G protein-coupled receptor 108
Genbank accession: ENST00000264080
Immunogen sequence/protein sequence: MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Protein accession: ENSP00000264080
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP
Related products: - FEM1C (Human) Recombinant Protein (P01)
- DUS3L (Human) Recombinant Protein (P01)
- CA10 (Human) Recombinant Protein (Q01)
- CA10 (Human) Recombinant Protein (Q02)
- TMEPAI (Human) Recombinant Protein (Q01)
Shipping condition: Dry Ice

Buy GPR108 (Human) Recombinant Protein now

Add to cart