NCLN polyclonal antibody (A01) View larger

NCLN polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCLN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about NCLN polyclonal antibody (A01)

Brand: Abnova
Reference: H00056926-A01
Product name: NCLN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NCLN.
Gene id: 56926
Gene name: NCLN
Gene alias: -
Gene description: nicalin homolog (zebrafish)
Genbank accession: NM_020170
Immunogen: NCLN (NP_064555, 44 a.a. ~ 144 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVY
Protein accession: NP_064555
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056926-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056926-A01-1-75-1.jpg
Application image note: NCLN polyclonal antibody (A01), Lot # 060703JCS1. Western Blot analysis of NCLN expression in Daoy.
Applications: WB-Ce,ELISA,WB-Re
Related products: - DUS3L MaxPab mouse polyclonal antibody (B01)
- CA10 MaxPab mouse polyclonal antibody (B01)
- DUSP22 polyclonal antibody (A01)
- DUSP22 MaxPab mouse polyclonal antibody (B01)
- DUSP22 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy NCLN polyclonal antibody (A01) now

Add to cart