LXN monoclonal antibody (M01), clone 8H5 View larger

LXN monoclonal antibody (M01), clone 8H5

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LXN monoclonal antibody (M01), clone 8H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about LXN monoclonal antibody (M01), clone 8H5

Brand: Abnova
Reference: H00056925-M01
Product name: LXN monoclonal antibody (M01), clone 8H5
Product description: Mouse monoclonal antibody raised against a partial recombinant LXN.
Clone: 8H5
Isotype: IgG2a Kappa
Gene id: 56925
Gene name: LXN
Gene alias: ECI|TCI
Gene description: latexin
Genbank accession: NM_020169
Immunogen: LXN (NP_064554.2, 151 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Protein accession: NP_064554.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056925-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056925-M01-1-7-1.jpg
Application image note: LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - CA10 monoclonal antibody (M01), clone 1A10
- TMEPAI monoclonal antibody (M01), clone 2A12
- DUSP22 monoclonal antibody (M01), clone 3D3
- MRPS22 monoclonal antibody (M10), clone 1E1
- C11orf30 monoclonal antibody (M01), clone 5D1
Shipping condition: Dry Ice

Buy LXN monoclonal antibody (M01), clone 8H5 now

Add to cart