Login to display prices
Login to display prices
LXN monoclonal antibody (M01), clone 8H5 View larger

LXN monoclonal antibody (M01), clone 8H5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LXN monoclonal antibody (M01), clone 8H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about LXN monoclonal antibody (M01), clone 8H5

Product description: Mouse monoclonal antibody raised against a partial recombinant LXN.
Clone: 8H5
Isotype: IgG2a Kappa
Gene id: 56925
Gene name: LXN
Gene alias: ECI|TCI
Gene description: latexin
Genbank accession: NM_020169
Immunogen: LXN (NP_064554.2, 151 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Protein accession: NP_064554.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: