LXN MaxPab mouse polyclonal antibody (B01) View larger

LXN MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LXN MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LXN MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056925-B01
Product name: LXN MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LXN protein.
Gene id: 56925
Gene name: LXN
Gene alias: ECI|TCI
Gene description: latexin
Genbank accession: NM_020169.2
Immunogen: LXN (NP_064554.2, 1 a.a. ~ 222 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Protein accession: NP_064554.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056925-B01-13-15-1.jpg
Application image note: Western Blot analysis of LXN expression in transfected 293T cell line (H00056925-T01) by LXN MaxPab polyclonal antibody.

Lane 1: LXN transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - NCLN polyclonal antibody (A01)
- DUS3L MaxPab mouse polyclonal antibody (B01)
- CA10 MaxPab mouse polyclonal antibody (B01)
- DUSP22 polyclonal antibody (A01)
- DUSP22 MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice

Buy LXN MaxPab mouse polyclonal antibody (B01) now

Add to cart