MCCC1 monoclonal antibody (M01), clone 2G8 View larger

MCCC1 monoclonal antibody (M01), clone 2G8

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCCC1 monoclonal antibody (M01), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MCCC1 monoclonal antibody (M01), clone 2G8

Brand: Abnova
Reference: H00056922-M01
Product name: MCCC1 monoclonal antibody (M01), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant MCCC1.
Clone: 2G8
Isotype: IgG2a Kappa
Gene id: 56922
Gene name: MCCC1
Gene alias: DKFZp686B20267|FLJ25545|MCC-B|MCCA
Gene description: methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
Genbank accession: NM_020166
Immunogen: MCCC1 (NP_064551, 526 a.a. ~ 625 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKEG
Protein accession: NP_064551
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056922-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056922-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MCCC1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - LXN monoclonal antibody (M01), clone 8H5
- CA10 monoclonal antibody (M01), clone 1A10
- TMEPAI monoclonal antibody (M01), clone 2A12
- DUSP22 monoclonal antibody (M01), clone 3D3
- MRPS22 monoclonal antibody (M10), clone 1E1
Shipping condition: Dry Ice

Buy MCCC1 monoclonal antibody (M01), clone 2G8 now

Add to cart