Login to display prices
Login to display prices
MCCC1 monoclonal antibody (M01), clone 2G8 View larger

MCCC1 monoclonal antibody (M01), clone 2G8

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCCC1 monoclonal antibody (M01), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MCCC1 monoclonal antibody (M01), clone 2G8

Product description: Mouse monoclonal antibody raised against a partial recombinant MCCC1.
Clone: 2G8
Isotype: IgG2a Kappa
Gene id: 56922
Gene name: MCCC1
Gene alias: DKFZp686B20267|FLJ25545|MCC-B|MCCA
Gene description: methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
Genbank accession: NM_020166
Immunogen: MCCC1 (NP_064551, 526 a.a. ~ 625 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKEG
Protein accession: NP_064551
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: