| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00056911-B01P |
| Product name: | C21orf7 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C21orf7 protein. |
| Gene id: | 56911 |
| Gene name: | C21orf7 |
| Gene alias: | HC21ORF7|TAK1L|TAKL|TAKL-1|TAKL-2|TAKL-4 |
| Gene description: | chromosome 21 open reading frame 7 |
| Genbank accession: | NM_020152.2 |
| Immunogen: | C21orf7 (NP_064537.1, 1 a.a. ~ 242 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS |
| Protein accession: | NP_064537.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of C21orf7 expression in transfected 293T cell line (H00056911-T01) by C21orf7 MaxPab polyclonal antibody. Lane 1: C21orf7 transfected lysate(26.62 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |