Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPIRE1 monoclonal antibody (M01), clone 4C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SPIRE1 monoclonal antibody (M01), clone 4C5
| Brand: | Abnova |
| Reference: | H00056907-M01 |
| Product name: | SPIRE1 monoclonal antibody (M01), clone 4C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPIRE1. |
| Clone: | 4C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56907 |
| Gene name: | SPIRE1 |
| Gene alias: | MGC150621|MGC150622|Spir-1 |
| Gene description: | spire homolog 1 (Drosophila) |
| Genbank accession: | NM_020148 |
| Immunogen: | SPIRE1 (NP_064533, 482 a.a. ~ 583 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI |
| Protein accession: | NP_064533 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SPIRE1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Actin S-Nitrosylation Inhibits Neutrophil {beta}2 Integrin Function.Thom SR, Bhopale VM, Mancini DJ, Milovanova TN. J Biol Chem. 2008 Apr 18;283(16):10822-34. Epub 2008 Feb 18. |