SPIRE1 polyclonal antibody (A01) View larger

SPIRE1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPIRE1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SPIRE1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00056907-A01
Product name: SPIRE1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SPIRE1.
Gene id: 56907
Gene name: SPIRE1
Gene alias: MGC150621|MGC150622|Spir-1
Gene description: spire homolog 1 (Drosophila)
Genbank accession: NM_020148
Immunogen: SPIRE1 (NP_064533, 482 a.a. ~ 583 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
Protein accession: NP_064533
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056907-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPIRE1 polyclonal antibody (A01) now

Add to cart