SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P) View larger

SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00056904-B01P
Product name: SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SH3GLB2 protein.
Gene id: 56904
Gene name: SH3GLB2
Gene alias: KIAA1848|PP6569|PP9455
Gene description: SH3-domain GRB2-like endophilin B2
Genbank accession: NM_020145
Immunogen: SH3GLB2 (NP_064530.1, 1 a.a. ~ 395 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Protein accession: NP_064530.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056904-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SH3GLB2 expression in transfected 293T cell line (H00056904-T01) by SH3GLB2 MaxPab polyclonal antibody.

Lane 1: SH3GLB2 transfected lysate(43.45 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SH3GLB2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart