AGPAT3 polyclonal antibody (A01) View larger

AGPAT3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGPAT3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about AGPAT3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00056894-A01
Product name: AGPAT3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant AGPAT3.
Gene id: 56894
Gene name: AGPAT3
Gene alias: LPAAT-GAMMA1|MGC4604
Gene description: 1-acylglycerol-3-phosphate O-acyltransferase 3
Genbank accession: NM_020132
Immunogen: AGPAT3 (NP_064517, 155 a.a. ~ 259 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP
Protein accession: NP_064517
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056894-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AGPAT3 polyclonal antibody (A01) now

Add to cart