Cart 10 Product Products 3 774,00 € (empty)
No products
To be determined Shipping
3 774,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 10 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 774,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 774,00 €
Data sheet of RAD18 monoclonal antibody (M01), clone 3H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about RAD18 monoclonal antibody (M01), clone 3H7
| Brand: | Abnova |
| Reference: | H00056852-M01 |
| Product name: | RAD18 monoclonal antibody (M01), clone 3H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD18. |
| Clone: | 3H7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 56852 |
| Gene name: | RAD18 |
| Gene alias: | RNF73 |
| Gene description: | RAD18 homolog (S. cerevisiae) |
| Genbank accession: | NM_020165 |
| Immunogen: | RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV |
| Protein accession: | NP_064550 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | RAD18 monoclonal antibody (M01), clone 3H7 Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.Sy SM, Jiang J, O WS, Deng Y, Huen MS Nucleic Acids Res. 2013 Jul 17. |