Brand: | Abnova |
Reference: | H00056852-M01 |
Product name: | RAD18 monoclonal antibody (M01), clone 3H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD18. |
Clone: | 3H7 |
Isotype: | IgG2b Kappa |
Gene id: | 56852 |
Gene name: | RAD18 |
Gene alias: | RNF73 |
Gene description: | RAD18 homolog (S. cerevisiae) |
Genbank accession: | NM_020165 |
Immunogen: | RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV |
Protein accession: | NP_064550 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | RAD18 monoclonal antibody (M01), clone 3H7 Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.Sy SM, Jiang J, O WS, Deng Y, Huen MS Nucleic Acids Res. 2013 Jul 17. |