Brand: | Abnova |
Reference: | H00056731-M01 |
Product name: | SLC2A4RG monoclonal antibody (M01), clone 5D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC2A4RG. |
Clone: | 5D2 |
Isotype: | IgG2a Kappa |
Gene id: | 56731 |
Gene name: | SLC2A4RG |
Gene alias: | GEF|HDBP1|Si-1-2|Si-1-2-19 |
Gene description: | SLC2A4 regulator |
Genbank accession: | NM_020062 |
Immunogen: | SLC2A4RG (NP_064446, 178 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM |
Protein accession: | NP_064446 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SLC2A4RG on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |