No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA | 
| Brand: | Abnova | 
| Reference: | H00056729-M29 | 
| Product name: | RETN monoclonal antibody (M29), clone 4C8 | 
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RETN. | 
| Clone: | 4C8 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 56729 | 
| Gene name: | RETN | 
| Gene alias: | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 | 
| Gene description: | resistin | 
| Genbank accession: | NM_020415 | 
| Immunogen: | RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV* | 
| Protein accession: | NP_065148 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Applications: | ELISA | 
| Shipping condition: | Dry Ice |