| Brand:  | Abnova | 
| Reference:  | H00056729-M25 | 
| Product name:  | RETN monoclonal antibody (M25), clone 2H8 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant RETN. | 
| Clone:  | 2H8 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 56729 | 
| Gene name:  | RETN | 
| Gene alias:  | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 | 
| Gene description:  | resistin | 
| Genbank accession:  | NM_020415 | 
| Immunogen:  | RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV* | 
| Protein accession:  | NP_065148 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA | 
| Shipping condition:  | Dry Ice |