Cart 19 Product Products 20 274,61 € (empty)
No products
265,00 € DAP Shipping
20 539,61 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 19 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 274,61 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 20 539,61 €
Data sheet of RETN monoclonal antibody (M23), clone 5E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RETN monoclonal antibody (M23), clone 5E8
| Brand: | Abnova |
| Reference: | H00056729-M23 |
| Product name: | RETN monoclonal antibody (M23), clone 5E8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RETN. |
| Clone: | 5E8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 56729 |
| Gene name: | RETN |
| Gene alias: | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 |
| Gene description: | resistin |
| Genbank accession: | NM_020415 |
| Immunogen: | RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV* |
| Protein accession: | NP_065148 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |