Brand: | Abnova |
Reference: | H00056704-A01 |
Product name: | JPH1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant JPH1. |
Gene id: | 56704 |
Gene name: | JPH1 |
Gene alias: | DKFZp762L0313|JP-1|JP1 |
Gene description: | junctophilin 1 |
Genbank accession: | NM_020647 |
Immunogen: | JPH1 (NP_065698, 501 a.a. ~ 579 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSA |
Protein accession: | NP_065698 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Altered expression and splicing of Ca(2+) metabolism genes in myotonic dystrophies DM1 and DM2.Vihola A, Sirito M, Bachinski LL, Raheem O, Screen M, Suominen T, Krahe R, Udd B. Neuropathol Appl Neurobiol. 2012 Jul 3. doi: 10.1111/j.1365-2990.2012.01289.x. |