Cart 76 Product Products 27 696,25 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x IL-2Rβ...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 696,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 76 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 696,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 696,25 €
Data sheet of KCNK12 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about KCNK12 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00056660-A01 |
| Product name: | KCNK12 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KCNK12. |
| Gene id: | 56660 |
| Gene name: | KCNK12 |
| Gene alias: | THIK-2|THIK2 |
| Gene description: | potassium channel, subfamily K, member 12 |
| Genbank accession: | NM_022055 |
| Immunogen: | KCNK12 (NP_071338, 166 a.a. ~ 215 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH |
| Protein accession: | NP_071338 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |