| Brand:  | Abnova | 
| Reference:  | H00056652-M03 | 
| Product name:  | PEO1 monoclonal antibody (M03), clone 1C5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PEO1. | 
| Clone:  | 1C5 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 56652 | 
| Gene name:  | C10orf2 | 
| Gene alias:  | ATXN8|FLJ21832|IOSCA|PEO|PEO1|PEOA3|SANDO|SCA8|TWINL | 
| Gene description:  | chromosome 10 open reading frame 2 | 
| Genbank accession:  | NM_021830 | 
| Immunogen:  | PEO1 (NP_068602.2, 591 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | DRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK | 
| Protein accession:  | NP_068602.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.08 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |