Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 385,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 385,00 €
Data sheet of PEO1 monoclonal antibody (M03), clone 1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PEO1 monoclonal antibody (M03), clone 1C5
| Brand: | Abnova |
| Reference: | H00056652-M03 |
| Product name: | PEO1 monoclonal antibody (M03), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PEO1. |
| Clone: | 1C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56652 |
| Gene name: | C10orf2 |
| Gene alias: | ATXN8|FLJ21832|IOSCA|PEO|PEO1|PEOA3|SANDO|SCA8|TWINL |
| Gene description: | chromosome 10 open reading frame 2 |
| Genbank accession: | NM_021830 |
| Immunogen: | PEO1 (NP_068602.2, 591 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK |
| Protein accession: | NP_068602.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |