Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF5A2 monoclonal antibody (M01), clone 1E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EIF5A2 monoclonal antibody (M01), clone 1E7
| Brand: | Abnova |
| Reference: | H00056648-M01 |
| Product name: | EIF5A2 monoclonal antibody (M01), clone 1E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF5A2. |
| Clone: | 1E7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 56648 |
| Gene name: | EIF5A2 |
| Gene alias: | EIF-5A2|eIF5AII |
| Gene description: | eukaryotic translation initiation factor 5A2 |
| Genbank accession: | NM_020390 |
| Immunogen: | EIF5A2 (NP_065123, 66 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK |
| Protein accession: | NP_065123 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EIF5A2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A Hypusine-eIF5A-PEAK1 Switch Regulates the Pathogenesis of Pancreatic Cancer.Fujimura K, Wright T, Strnadel J, Kaushal S, Metildi C, Lowy AM, Bouvet M, Kelber JA, Klemke RL Cancer Res. 2014 Nov 15;74(22):6671-81. doi: 10.1158/0008-5472.CAN-14-1031. Epub 2014 Sep 26. |