Cart 3 Product Products 1 059,00 € (empty)
No products
To be determined Shipping
1 059,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 059,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 059,00 €
Data sheet of DIABLO monoclonal antibody (M02A), clone 4F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about DIABLO monoclonal antibody (M02A), clone 4F9
| Brand: | Abnova |
| Reference: | H00056616-M02A |
| Product name: | DIABLO monoclonal antibody (M02A), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DIABLO. |
| Clone: | 4F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56616 |
| Gene name: | DIABLO |
| Gene alias: | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene description: | diablo homolog (Drosophila) |
| Genbank accession: | BC011909 |
| Immunogen: | DIABLO (AAH11909, 119 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ |
| Protein accession: | AAH11909 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DIABLO expression in transfected 293T cell line by DIABLO monoclonal antibody (M02A), clone 4F9. Lane 1: DIABLO transfected lysate(27.131 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |