| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00056616-B01P |
| Product name: | DIABLO purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DIABLO protein. |
| Gene id: | 56616 |
| Gene name: | DIABLO |
| Gene alias: | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene description: | diablo homolog (Drosophila) |
| Genbank accession: | NM_019887.3 |
| Immunogen: | DIABLO (NP_063940.1, 1 a.a. ~ 239 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Protein accession: | NP_063940.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of DIABLO expression in transfected 293T cell line (H00056616-T01) by DIABLO MaxPab polyclonal antibody. Lane 1: DIABLO transfected lysate(26.29 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |