No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00056604-B01P |
| Product name: | TUBB4Q purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TUBB4Q protein. |
| Gene id: | 56604 |
| Gene name: | TUBB4Q |
| Gene alias: | - |
| Gene description: | tubulin, beta polypeptide 4, member Q |
| Genbank accession: | BC146475 |
| Immunogen: | TUBB4Q (AAI46476.1, 1 a.a. ~ 434 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV |
| Protein accession: | AAI46476.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TUBB4Q expression in transfected 293T cell line (H00056604-T01) by TUBB4Q MaxPab polyclonal antibody. Lane 1: TUBB4Q transfected lysate(47.74 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A Genome-Wide siRNA Screen to Identify Host Factors Necessary for Growth of the Parasite Toxoplasma gondii.Moser LA, Pollard AM, Knoll LJ PLoS One. 2013 Jun 28;8(6):e68129. doi: 10.1371/journal.pone.0068129. Print 2013. |