Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYP26B1 monoclonal antibody (M01), clone 1H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CYP26B1 monoclonal antibody (M01), clone 1H6
| Brand: | Abnova |
| Reference: | H00056603-M01 |
| Product name: | CYP26B1 monoclonal antibody (M01), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP26B1. |
| Clone: | 1H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56603 |
| Gene name: | CYP26B1 |
| Gene alias: | CYP26A2|DKFZp686G0638|MGC129613|P450RAI-2 |
| Gene description: | cytochrome P450, family 26, subfamily B, polypeptide 1 |
| Genbank accession: | NM_019885 |
| Immunogen: | CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF |
| Protein accession: | NP_063938 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6. Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Cloning and Functional Studies of a Splice Variant of CYP26B1 Expressed in Vascular Cells.Elmabsout AA, Kumawat A, Saenz-Mendez P, Krivospitskaya O, Savenstrand H, Olofsson PS, Eriksson LA, Strid A, Valen G, Torma H, Sirsjo A. PLoS One. 2012;7(5):e36839. Epub 2012 May 29. |