No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00056288-M03 |
Product name: | PARD3 monoclonal antibody (M03), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PARD3. |
Clone: | 4G5 |
Isotype: | IgG2a Kappa |
Gene id: | 56288 |
Gene name: | PARD3 |
Gene alias: | ASIP|Baz|Bazooka|FLJ21015|PAR3|PAR3alpha|PARD3A|SE2-5L16|SE2-5LT1|SE2-5T2 |
Gene description: | par-3 partitioning defective 3 homolog (C. elegans) |
Genbank accession: | BC011711 |
Immunogen: | PARD3 (AAH11711, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS |
Protein accession: | AAH11711 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PARD3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |