| Brand:  | Abnova | 
| Reference:  | H00056287-M04 | 
| Product name:  | GKN1 monoclonal antibody (M04), clone 1G17 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant GKN1. | 
| Clone:  | 1G17 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 56287 | 
| Gene name:  | GKN1 | 
| Gene alias:  | AMP18|BRICD1|CA11|FOV|MGC70354|foveolin | 
| Gene description:  | gastrokine 1 | 
| Genbank accession:  | BC059778 | 
| Immunogen:  | GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN | 
| Protein accession:  | AAH59778 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged GKN1 is 0.3 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |