| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00056287-M01 | 
| Product name: | GKN1 monoclonal antibody (M01), clone 2E5 | 
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GKN1. | 
| Clone: | 2E5 | 
| Isotype: | IgG1 kappa | 
| Gene id: | 56287 | 
| Gene name: | GKN1 | 
| Gene alias: | AMP18|BRICD1|CA11|FOV|MGC70354|foveolin | 
| Gene description: | gastrokine 1 | 
| Genbank accession: | BC059778 | 
| Immunogen: | GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN | 
| Protein accession: | AAH59778 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (43.89 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5. Lane 1: GKN1 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice | 
| Publications: | Anti-amyloidogenic property of human gastrokine 1.Altieri F, Di Stadio CS, Severino V, Sandomenico A, Minopoli G, Miselli G, Di Maro A, Ruvo M, Chambery A, Quagliariello V, Masullo M, Rippa E, Arcari P. Biochimie. 2014 Nov;106:91-100.  |