| Brand: | Abnova |
| Reference: | H00056256-M02 |
| Product name: | SERTAD4 monoclonal antibody (M02), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SERTAD4. |
| Clone: | 3G11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 56256 |
| Gene name: | SERTAD4 |
| Gene alias: | DJ667H12.2 |
| Gene description: | SERTA domain containing 4 |
| Genbank accession: | NM_019605.2 |
| Immunogen: | SERTAD4 (NP_062551.1, 1 a.a. ~ 356 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTLVLSMNRFCEPIVSEGAAEIAGYQTLWEADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPITTSKITYFKRKYVEEEDFHPPLSSCSHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIHGEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANVGSASTAASSPSASSSSSSSSSSPPLPLPSCSRQVDFDVGSASIYKSDGQIPANEIFVTNVRSLGVQEKAKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSKI |
| Protein accession: | NP_062551.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (65.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | SERTAD4 monoclonal antibody (M02), clone 3G11. Western Blot analysis of SERTAD4 expression in SK-BR-3. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |