Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MRAP monoclonal antibody (M01A), clone 3D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MRAP monoclonal antibody (M01A), clone 3D12
| Brand: | Abnova |
| Reference: | H00056246-M01A |
| Product name: | MRAP monoclonal antibody (M01A), clone 3D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MRAP. |
| Clone: | 3D12 |
| Isotype: | IgM Kappa |
| Gene id: | 56246 |
| Gene name: | MRAP |
| Gene alias: | B27|C21orf61|FALP|FGD2|GCCD2 |
| Gene description: | melanocortin 2 receptor accessory protein |
| Genbank accession: | NM_178817 |
| Immunogen: | MRAP (NP_848932.1, 69 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS |
| Protein accession: | NP_848932.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |