Brand: | Abnova |
Reference: | H00056242-D01P |
Product name: | ZNF253 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ZNF253 protein. |
Gene id: | 56242 |
Gene name: | ZNF253 |
Gene alias: | BMZF-1|BMZF1|FLJ90391|ZNF411 |
Gene description: | zinc finger protein 253 |
Genbank accession: | NM_021047.2 |
Immunogen: | ZNF253 (NP_066385.2, 1 a.a. ~ 499 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDLVTCLEQGKKPLTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKAFKRSSTLTTHKKIHTGEKPYRCEECGKAFNQSANLTTHKRIHTGEKPYRCEECGKAFKQSSNLTTHKKIHTGEKPYKCEECGKAFNRSTDLTTHKIVHTGEKPYKCEECGKAFKHPSHVTTHKKIHTRGKPYNCEECGKSFKHCSNLTIHKRIHTGEKPYKCEECGKAFHLSSHLTTHKILHTGEKPYRCRECGKAFNHSTTLFSHEKIHTGEKPYKCDECGKTFTWPSILSKHKRTHTGEKPYKCEECGKSFTASSTLTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERKPYIVKNVTDLLNVPPLLISIR |
Protein accession: | NP_066385.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZNF253 MaxPab rabbit polyclonal antibody. Western Blot analysis of ZNF253 expression in Jurkat. |
Applications: | WB-Ce |
Shipping condition: | Dry Ice |