| Brand: | Abnova |
| Reference: | H00056132-A01 |
| Product name: | PCDHB3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PCDHB3. |
| Gene id: | 56132 |
| Gene name: | PCDHB3 |
| Gene alias: | PCDH-BETA3 |
| Gene description: | protocadherin beta 3 |
| Genbank accession: | NM_018937 |
| Immunogen: | PCDHB3 (NP_061760, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENSGETVLAVFSVSDLDSGDNGRV |
| Protein accession: | NP_061760 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |