| Brand:  | Abnova | 
| Reference:  | H00056126-M07 | 
| Product name:  | PCDHB10 monoclonal antibody (M07), clone 4C4 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PCDHB10. | 
| Clone:  | 4C4 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 56126 | 
| Gene name:  | PCDHB10 | 
| Gene alias:  | PCDH-BETA10|PCHB10 | 
| Gene description:  | protocadherin beta 10 | 
| Genbank accession:  | NM_018930 | 
| Immunogen:  | PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD | 
| Protein accession:  | NP_061753 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse | 
| Application image:  |   | 
| Application image note:  | PCDHB10 monoclonal antibody (M07), clone 4C4 Western Blot analysis of PCDHB10 expression in NIH/3T3 ( Cat # L018V1 ). | 
| Applications:  | WB-Ce,IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer.Balagurunathan Y, Morse DL, Hostetter G, Shanmugam V, Stafford P, Shack S, Pearson J, Trissal M, Demeure MJ, Von Hoff DD, Hruby VJ, Gillies RJ, Han H. Mol Cancer Ther. 2008 Sep;7(9):3071-80. Epub 2008 Sep 2. |