| Brand: | Abnova |
| Reference: | H00056113-M01 |
| Product name: | PCDHGA2 monoclonal antibody (M01), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDHGA2. |
| Clone: | 2A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 56113 |
| Gene name: | PCDHGA2 |
| Gene alias: | PCDH-GAMMA-A2 |
| Gene description: | protocadherin gamma subfamily A, 2 |
| Genbank accession: | NM_018915 |
| Immunogen: | PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA |
| Protein accession: | NP_061738 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | PCDHGA2 monoclonal antibody (M01), clone 2A7. Western Blot analysis of PCDHGA2 expression in Raw 264.7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |