| Brand:  | Abnova | 
| Reference:  | H00055937-M03 | 
| Product name:  | APOM monoclonal antibody (M03), clone 1G9 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant APOM. | 
| Clone:  | 1G9 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 55937 | 
| Gene name:  | APOM | 
| Gene alias:  | G3a|HSPC336|MGC22400|NG20 | 
| Gene description:  | apolipoprotein M | 
| Genbank accession:  | BC020683 | 
| Immunogen:  | APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN | 
| Protein accession:  | AAH20683 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (44 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged APOM is 0.1 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Protein Unfolding allow use of Commercial Antibodies in an Apolipoprotein M sandwich ELISA.Bosteen MH, Dahlback B, Nielsen LB, Christoffersen C J Lipid Res. 2015 Jan 5. pii: jlr.D055947. |