| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00055929-M02 | 
| Product name: | DMAP1 monoclonal antibody (M02), clone 1A5 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DMAP1. | 
| Clone: | 1A5 | 
| Isotype: | IgG1 Kappa | 
| Gene id: | 55929 | 
| Gene name: | DMAP1 | 
| Gene alias: | DKFZp686L09142|DNMAP1|DNMTAP1|EAF2|FLJ11543|KIAA1425|SWC4 | 
| Gene description: | DNA methyltransferase 1 associated protein 1 | 
| Genbank accession: | NM_019100 | 
| Immunogen: | DMAP1 (NP_061973, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF | 
| Protein accession: | NP_061973 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of DMAP1 expression in transfected 293T cell line by DMAP1 monoclonal antibody (M02), clone 1A5. Lane 1: DMAP1 transfected lysate(53 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | ELISA,WB-Tr | 
| Shipping condition: | Dry Ice |