| Brand:  | Abnova | 
| Reference:  | H00055911-M03 | 
| Product name:  | APOB48R monoclonal antibody (M03), clone 2D7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant APOB48R. | 
| Clone:  | 2D7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 55911 | 
| Gene name:  | APOB48R | 
| Gene alias:  | - | 
| Gene description:  | apolipoprotein B48 receptor | 
| Genbank accession:  | NM_018690 | 
| Immunogen:  | APOB48R (NP_061160, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE | 
| Protein accession:  | NP_061160 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to APOB48R on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml] | 
| Applications:  | IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Apolipoprotein E-deficient lipoproteins induce foam cell formation by downregulation of lysosomal hydrolases in macrophages.Wu D, Sharan C, Yang H, Goodwin JS, Zhou L, Grabowski GA, Du H, Guo Z. J Lipid Res. 2007 Dec;48(12):2571-8. Epub 2007 Aug 25. |