No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055897-M09 |
Product name: | MESP1 monoclonal antibody (M09), clone 4B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MESP1. |
Clone: | 4B4 |
Isotype: | IgG2a Kappa |
Gene id: | 55897 |
Gene name: | MESP1 |
Gene alias: | MGC10676|bHLHc5 |
Gene description: | mesoderm posterior 1 homolog (mouse) |
Genbank accession: | NM_018670 |
Immunogen: | MESP1 (NP_061140.1, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD |
Protein accession: | NP_061140.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MESP1 monoclonal antibody (M09), clone 4B4 Western Blot analysis of MESP1 expression in COLO 320 HSR ( Cat # L020V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |