| Brand: | Abnova |
| Reference: | H00055897-M06 |
| Product name: | MESP1 monoclonal antibody (M06), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MESP1. |
| Clone: | 1F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55897 |
| Gene name: | MESP1 |
| Gene alias: | MGC10676|bHLHc5 |
| Gene description: | mesoderm posterior 1 homolog (mouse) |
| Genbank accession: | NM_018670 |
| Immunogen: | MESP1 (NP_061140.1, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD |
| Protein accession: | NP_061140.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MESP1 monoclonal antibody (M06), clone 1F9. Western Blot analysis of MESP1 expression in FHs 173 WE. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |