No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055885-M10 |
Product name: | LMO3 monoclonal antibody (M10), clone 3H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LMO3. |
Clone: | 3H8 |
Isotype: | IgG2b Kappa |
Gene id: | 55885 |
Gene name: | LMO3 |
Gene alias: | DAT1|MGC26081|RBTN3|RBTNL2|RHOM3|Rhom-3 |
Gene description: | LIM domain only 3 (rhombotin-like 2) |
Genbank accession: | NM_018640 |
Immunogen: | LMO3 (NP_061110, 5 a.a. ~ 98 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVY |
Protein accession: | NP_061110 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |