| Brand: | Abnova |
| Reference: | H00055885-M03 |
| Product name: | LMO3 monoclonal antibody (M03), clone 2H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LMO3. |
| Clone: | 2H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55885 |
| Gene name: | LMO3 |
| Gene alias: | DAT1|MGC26081|RBTN3|RBTNL2|RHOM3|Rhom-3 |
| Gene description: | LIM domain only 3 (rhombotin-like 2) |
| Genbank accession: | NM_018640 |
| Immunogen: | LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR |
| Protein accession: | NP_061110 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LMO3 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |