| Brand:  | Abnova | 
| Reference:  | H00055872-M07 | 
| Product name:  | PBK monoclonal antibody (M07), clone 3A7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PBK. | 
| Clone:  | 3A7 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 55872 | 
| Gene name:  | PBK | 
| Gene alias:  | FLJ14385|Nori-3|SPK|TOPK | 
| Gene description:  | PDZ binding kinase | 
| Genbank accession:  | BC015191 | 
| Immunogen:  | PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS | 
| Protein accession:  | AAH15191 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.73 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |