PBK monoclonal antibody (M06), clone 4A10 View larger

PBK monoclonal antibody (M06), clone 4A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PBK monoclonal antibody (M06), clone 4A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about PBK monoclonal antibody (M06), clone 4A10

Brand: Abnova
Reference: H00055872-M06
Product name: PBK monoclonal antibody (M06), clone 4A10
Product description: Mouse monoclonal antibody raised against a partial recombinant PBK.
Clone: 4A10
Isotype: IgG2b Kappa
Gene id: 55872
Gene name: PBK
Gene alias: FLJ14385|Nori-3|SPK|TOPK
Gene description: PDZ binding kinase
Genbank accession: BC015191
Immunogen: PBK (AAH15191, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS
Protein accession: AAH15191
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055872-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055872-M06-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PBK monoclonal antibody (M06), clone 4A10 now

Add to cart