No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00055863-D01 |
| Product name: | TMEM126B MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TMEM126B protein. |
| Gene id: | 55863 |
| Gene name: | TMEM126B |
| Gene alias: | HT007|MGC111203 |
| Gene description: | transmembrane protein 126B |
| Genbank accession: | NM_018480 |
| Immunogen: | TMEM126B (NP_060950.2, 1 a.a. ~ 200 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE |
| Protein accession: | NP_060950.2 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | TMEM126B MaxPab rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney. |
| Applications: | WB-Ti,WB-Tr,IP |
| Shipping condition: | Dry Ice |