Cart 189 Product Products 53 647,31 € (empty)
-
1 x Olfactory...259,07 € -
-
-
-
-
-
-
1 x RGS5...259,07 € -
-
-
1 x SR-1B...259,07 € -
-
-
-
-
-
-
-
1 x KVβ.3...259,07 € -
-
-
-
1 x PDGFR-α...259,07 € -
-
-
-
-
-
-
-
-
1 x MAK...259,07 € -
-
-
-
1 x CIDE-B...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ATP5J2...259,07 € -
-
-
-
1 x PRPF31...259,07 € -
-
-
-
-
-
-
1 x DECR2...259,07 € -
-
-
-
-
-
-
-
1 x Claudin-7...259,07 € -
-
-
-
1 x USP50...259,07 € -
1 x Phospho-CD...259,07 € -
1 x FXR2...259,07 € -
1 x N-CoR...259,07 € -
-
-
1 x GPR160...259,07 € -
-
1 x UBR5...259,07 € -
-
-
-
-
-
-
-
1 x VIM...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x UBE2T...259,07 € -
1 x Nap1...259,07 € -
1 x INPP5J...259,07 € -
-
-
-
1 x IKKα...259,07 € -
-
1 x GPR10...259,07 € -
-
-
-
-
1 x Phospho-CK...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x Phospho-HS...259,07 € -
-
-
-
-
-
1 x Myt 1...259,07 € -
1 x DDR1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x 14-3-3 ε...259,07 € -
1 x CKR-5...259,07 € -
-
-
-
-
-
-
1 x Olfactory...259,07 € -
-
-
-
-
-
-
-
-
1 x Olfactory...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
53 647,31 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 189 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 53 647,31 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 53 647,31 €
Data sheet of PSENEN polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PSENEN polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00055851-A01 |
| Product name: | PSENEN polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PSENEN. |
| Gene id: | 55851 |
| Gene name: | PSENEN |
| Gene alias: | MDS033|MSTP064|PEN-2|PEN2 |
| Gene description: | presenilin enhancer 2 homolog (C. elegans) |
| Genbank accession: | BC009575 |
| Immunogen: | PSENEN (AAH09575, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP |
| Protein accession: | AAH09575 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |