| Brand:  | Abnova | 
| Reference:  | H00055832-M05 | 
| Product name:  | CAND1 monoclonal antibody (M05), clone 1G5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CAND1. | 
| Clone:  | 1G5 | 
| Isotype:  | IgG3 Kappa | 
| Gene id:  | 55832 | 
| Gene name:  | CAND1 | 
| Gene alias:  | DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A | 
| Gene description:  | cullin-associated and neddylation-dissociated 1 | 
| Genbank accession:  | NM_018448 | 
| Immunogen:  | CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE | 
| Protein accession:  | NP_060918 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse,Rat | 
| Application image:  |   | 
| Application image note:  | CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in Hela S3 NE ( Cat # L013V3 ). | 
| Applications:  | WB-Ce,IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |